PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM03G09500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 292aa    MW: 30516.2 Da    PI: 8.418
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM03G09500.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.25.9e-18126180256
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      rk+ ++tkeq   Le+ F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  OGLUM03G09500.1 126 RKKLRLTKEQSALLEDRFREHSTLNPKQKVALAKQLNLRPRQVEVWFQNRRARTK 180
                      788899***********************************************98 PP

2HD-ZIP_I/II125.23e-40126215191
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                      +kk+rl+keq++lLE+ F+e+++L+p++Kv+la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL++e +eLr +l
  OGLUM03G09500.1 126 RKKLRLTKEQSALLEDRFREHSTLNPKQKVALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCETLTEENRRLQRELQELR-AL 215
                      69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-17113181IPR009057Homeodomain-like
SuperFamilySSF466891.11E-18119183IPR009057Homeodomain-like
PROSITE profilePS5007117.216122182IPR001356Homeobox domain
SMARTSM003892.1E-15124186IPR001356Homeobox domain
PfamPF000462.7E-15126180IPR001356Homeobox domain
CDDcd000868.17E-16126183No hitNo description
PROSITE patternPS000270157180IPR017970Homeobox, conserved site
PfamPF021836.9E-11182216IPR003106Leucine zipper, homeobox-associated
SMARTSM003402.7E-24182225IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MAQEDVGHLS DAGLALGLSL GGGGGGTTDA AAAHRGGCRR PSPSSQCPPL EPSLTLSLPD  60
DAAAGAAATA TATASGGGGP AHSVSSLSVG AAAAAAVKRE RAEEADGERV SSTAAGRDDD  120
DDGSTRKKLR LTKEQSALLE DRFREHSTLN PKQKVALAKQ LNLRPRQVEV WFQNRRARTK  180
LKQTEVDCEF LKRCCETLTE ENRRLQRELQ ELRALKFAPP PPSSAAHQPS PAPPAPFYMQ  240
LPAATLTICP SCERVGGPAS AAKVVAADGT KAGPGRTTTH HFFNPFTHSA AC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1124130TRKKLRL
2174182RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1059270.0AC105927.2 Oryza sativa Japonica Group chromosome 3 clone OJ1781E12, complete sequence.
GenBankAC1351570.0AC135157.2 Oryza sativa Japonica Group chromosome 3 clone OJ1017C11, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankCP0126110.0CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015627844.10.0PREDICTED: homeobox-leucine zipper protein HOX19 isoform X2
SwissprotQ8GRL40.0HOX19_ORYSJ; Homeobox-leucine zipper protein HOX19
SwissprotA2XE760.0HOX19_ORYSI; Homeobox-leucine zipper protein HOX19
TrEMBLA0A0E0GEI40.0A0A0E0GEI4_ORYNI; Uncharacterized protein
TrEMBLA0A0D9Z4B90.0A0A0D9Z4B9_9ORYZ; Uncharacterized protein
STRINGBGIOSGA012175-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os03g12860.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20553698
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.11e-56homeobox from Arabidopsis thaliana